C17orf58 Recombinant Protein Antigen

Name C17orf58 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-86418PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody C17orf58 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene C17orf58
Sequence FRVHMLALDSSSCNKPCPEFKPGSRYIVMGHIYHKRRQLPTALLQVLRGRLRPGDGLLRSSSSYVKRFNRKREGQIQGAIH
Description A recombinant protein antigen corresponding to C17ORF58
Supplier Page Shop