EPS15 Recombinant Protein Antigen

Name EPS15 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-89221PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody EPS15 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene EPS15
Sequence CFFRQSTDPFATSSTDPFSAANNSSITSVETLKHNDPFAPGGTVVAASDSATDPFASVFGNESFGGGFADFSTLSKVNNEDPFRSATSSSVSNVVITKNVFEETSVKSEDEPPALPPKIGTPTRPCPLPPGKRSINKLDSPD
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EPS15
Supplier Page Shop