| Name | Active human IGF1 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab191621 |
| Category | Protein |
| Prices | $192.00 |
| Sizes | 100 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | The ED 50 was determined by a cell proliferation assay using FDC-P1 cells is ≤ 1.0 ng/mL, corresponding to a specific activity of ≥ 1.0 x 10 6 units/mg. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P05019 |
| Gene | IGF1 |
| Residue | 49 to 118 |
| Sequence | GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFR SCDLRRLEMYCAPLKPAKSA |
| Supplier Page | Shop |