NRG2 Recombinant Protein (OPCA01761)

Name NRG2 Recombinant Protein (OPCA01761)
Supplier Aviva Systems Biology
Catalog OPCA01761
Category Protein
Prices $250.00
Sizes 50 µg
Nature Recombinant
Source Human
Tag/Conjugation His-SUMO-tag
Purity Greater than 90% as determined by SDS-PAGE.
SwissProt/Accession O14511
Gene NRG2
Sequence CYSPSLKSVQDQAYKAPVVVEGKVQGLVPAGGSSSNSTREPPASGRVALVKVLDKWPLRSGGLQREQVISVGSCVPLERNQRYIFFLEPTEQPLVFKTAFAPLDTNGKNLKKEVGKILCTDCATRPKLKKMKSQTGQVGEKQSLKCEAAAGNPQPSYRWFKDGKELNRSRDIRIKYGNGRKNSRLQFNKVKVEDAGEYVCEAENILGKDTVRGRLYVNSVSTTLSSWSGHARKCNETAKSYCVNGGVCYYIEGIN
Description This gene encodes a novel member of the neuregulin family of growth and differentiation factors
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.