NUP153 Recombinant Protein (OPCA01763)

Name NUP153 Recombinant Protein (OPCA01763)
Supplier Aviva Systems Biology
Catalog OPCA01763
Category Protein
Prices $250.00
Sizes 50 µg
Nature Recombinant
Source Human
Tag/Conjugation His-tag
Purity Greater than 90% as determined by SDS-PAGE.
SwissProt/Accession P49790
Gene NUP153
Sequence KAGSSWQCDTCLLQNKVTDNKCIACQAAKLSPRDTAKQTGIETPNKSGKTTLSASGTGFGDKFKPVIGTWDCDTCLVQNKPEAIKCVACETPKPGTCVKRALTLTVVSESAETMTASSSSCTVTTGTLGFGDKFKRPIGSWECSVCCVSNNAEDNKCVSCMSEKPGSSVPASSSSTVPVSLPSGGSLGLEKFKKPEGSWDCELCLVQNKADSTKCLACESAKPG
Description Nuclear pore complexes regulate the transport of macromolecules between the nucleus and cytoplasm
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.