PPM1B Recombinant Protein (OPCA01793)

Name PPM1B Recombinant Protein (OPCA01793)
Supplier Aviva Systems Biology
Catalog OPCA01793
Category Protein
Prices $250.00
Sizes 50 µg
Nature Recombinant
Source Human
Tag/Conjugation His-SUMO-tag
Purity Greater than 90% as determined by SDS-PAGE.
SwissProt/Accession O75688
Gene PPM1B
Sequence MSIVLVCFSNAPKVSDEAVKKDSELDKHLESRVEEIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSRLNPHRESDGASDEAEESGSQGKLVEALRQMRINHRGNYRQLLEEMLTSYRLAKVEGEESPAEPAATATSSNSDAGNPVTMQESHTESESGLAELDSSNEDAGTKMSGEKI
Description The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.