| Name | PTH2R Recombinant Protein (OPCA01806) |
|---|---|
| Supplier | Aviva Systems Biology |
| Catalog | OPCA01806 |
| Category | Protein |
| Prices | $250.00 |
| Sizes | 50 µg |
| Nature | Recombinant |
| Source | Human |
| Tag/Conjugation | His-SUMO-tag |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| SwissProt/Accession | P49190 |
| Gene | PTH2R |
| Sequence | DSDGTITIEEQIVLVLKAKVQCELNITAQLQEGEGNCFPEWDGLICWPRGTVGKISAVPCPPYIYDFNHKGVAFRHCNPNGTWDFMHSLNKTWANYSDCLRFLQPDISIGKQEFFERLY |
| Description | The protein encoded by this gene is a member of the G-protein coupled receptor 2 family |
| Supplier Page | Shop |