XPC Recombinant Protein (OPCA01929)

Name XPC Recombinant Protein (OPCA01929)
Supplier Aviva Systems Biology
Catalog OPCA01929
Category Protein
Prices $250.00
Sizes 50 µg
Nature Recombinant
Source Human
Tag/Conjugation His-tag
Purity Greater than 90% as determined by SDS-PAGE.
SwissProt/Accession Q01831
Gene XPC
Sequence SLPAASSSSSSSKRGKKMCSDGEKAEKRSIAGIDQWLEVFCEQEEKWVCVDCVHGVVGQPLTCYKYATKPMTYVVGIDSDGWVRDVTQRYDPVWMTVTRKCRVDAEWWAETLRPYQSPFMDREKKEDLEFQAKHMDQPLPTAIGLYKNHPLYALKRHLLKYEAIYPETAAILGYCRGEAVYSRDCVHTLHSRDTWLKKARVVRLGEVPYKMVKGFSNRARKARLAEPQLREENDLGLFG
Description This gene encodes a component of the nucleotide excision repair (NER) pathway
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.