Dio3 Recombinant Protein (OPCA02085)

Name Dio3 Recombinant Protein (OPCA02085)
Supplier Aviva Systems Biology
Catalog OPCA02085
Category Protein
Prices $250.00
Sizes 50 µg
Nature Recombinant
Source Rat
Tag/Conjugation His-tag
Purity Greater than 90% as determined by SDS-PAGE.
SwissProt/Accession P49897
Gene Dio3
Sequence DFLCIRKHFLRRRHPDHPEPEVELNSEGEEMPPDDPPICVSDDNRLCTLASLKAVWHGQKLDFFKQAHEGGPAPNSEVVRPDGFQSQRILDYAQGTRPLVLNFGSCTPPFMARMSAFQRLVTKYQRDVDFLIIYIEEAHPSDGWVTTDSPYVIPQHRSLEDRVSAARVLQQGAPGCALVLDTMANSSSSAYGAYFERLYVIQSGTIMYQGGRGPDGYQVSELRTWLERYDEQLHGTRPRRL
Description The protein encoded by this intronless gene belongs to the iodothyronine deiodinase family
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.