| Name | SRSF10 Recombinant Protein (OPCA02208) |
|---|---|
| Supplier | Aviva Systems Biology |
| Catalog | OPCA02208 |
| Category | Protein |
| Prices | $250.00 |
| Sizes | 50 µg |
| Nature | Recombinant |
| Source | Human |
| Tag/Conjugation | His-SUMO-tag |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| SwissProt/Accession | O75494 |
| Gene | SRSF10 |
| Sequence | MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLDRKWICGRQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRSRSYERRRSRSRSFDYNYRRSYSPRNSRPTGRPRRSRSHSDNDRPNCSWNTQYSSAYYTSRKI |
| Description | This gene product is a member of the serine-arginine (SR) family of proteins, which are involved in constitutive and regulated RNA splicing |
| Supplier Page | Shop |