Name | NABP1 Recombinant Protein (OPCA02421) |
---|---|
Supplier | Aviva Systems Biology |
Catalog | OPCA02421 |
Category | Protein |
Prices | $250.00 |
Sizes | 50 µg |
Nature | Recombinant |
Source | Human |
Tag/Conjugation | His-SUMO-tag |
Purity | Greater than 90% as determined by SDS-PAGE. |
SwissProt/Accession | Q96AH0 |
Gene | NABP1 |
Sequence | MNRVNDPLIFIRDIKPGLKNLNVVFIVLEIGRVTKTKDGHEVRSCKVADKTGSITISVWDEIGGLIQPGDIIRLTRGYASMWKGCLTLYTGRGGELQKIGEFCMVYSEVPNFSEPNPDYRGQQNKGAQSEQKNNSMNSNMGTGTFGPVGNGVHTGPESREHQFSHAGRSNGRGLINPQLQGTASNQTVMTTISNGRDPRRAFKR |
Description | Single-stranded DNA (ssDNA)-binding proteins, such as OBFC2A, are ubiquitous and essential for a variety of DNA metabolic processes, including replication, recombination, and detection and repair of damage (Richard et al., 2008 [PubMed 18449195]).[supplied by OMIM, Jun 2008] |
Supplier Page | Shop |