| Name | GEMIN7 Recombinant Protein (OPCA02457) |
|---|---|
| Supplier | Aviva Systems Biology |
| Catalog | OPCA02457 |
| Category | Protein |
| Prices | $250.00 |
| Sizes | 50 µg |
| Nature | Recombinant |
| Source | Human |
| Tag/Conjugation | GST-tag |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| SwissProt/Accession | Q9H840 |
| Gene | GEMIN7 |
| Sequence | MQTPVNIPVPVLRLPRGPDGFSRGFAPDGRRAPLRPEVPEIQECPIAQESLESQEQRARAALRERYLRSLLAMVGHQVSFTLHEGVRVAAHFGATDLDVANFYVSQLQTPIGVQAEALLRCSDIISYTFKP |
| Description | The protein encoded by this gene is a component of the core SMN complex, which is required for pre-mRNA splicing in the nucleus |
| Supplier Page | Shop |