| Name | DUSP26 Recombinant Protein (OPCA02463) |
|---|---|
| Supplier | Aviva Systems Biology |
| Catalog | OPCA02463 |
| Category | Protein |
| Prices | $250.00 |
| Sizes | 50 µg |
| Nature | Recombinant |
| Source | Human |
| Tag/Conjugation | His-SUMO-tag |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| SwissProt/Accession | Q9BV47 |
| Gene | DUSP26 |
| Sequence | MCPGNWLWASMTFMARFSRSSSRSPVRTRGTLEEMPTVQHPFLNVFELERLLYTGKTACNHADEVWPGLYLGDQDMANNRRELRRLGITHVLNASHSRWRGTPEAYEGLGIRYLGVEAHDSPAFDMSIHFQTAADFIHRALSQPGGKILVHCAVGVSRSATLVLAYLMLYHHLTLVEAIKKVKDHRGIIPNRGFLRQLLALDRRLRQGLEA |
| Description | This gene encodes a member of the tyrosine phosphatase family of proteins and exhibits dual specificity by dephosphorylating tyrosine as well as serine and threonine residues |
| Supplier Page | Shop |