CYP4F11 Recombinant Protein (OPCA02490)

Name CYP4F11 Recombinant Protein (OPCA02490)
Supplier Aviva Systems Biology
Catalog OPCA02490
Category Protein
Prices $250.00
Sizes 50 µg
Nature Recombinant
Source Human
Tag/Conjugation His-SUMO-tag
Purity Greater than 90% as determined by SDS-PAGE.
SwissProt/Accession Q9HBI6
Gene CYP4F11
Sequence TYTFYDNCRRLQCFPQPPKQNWFWGHQGLVTPTEEGMKTLTQLVTTYPQGFKLWLGPTFPLLILCHPDIIRPITSASAAVAPKDMIFYGFLKPWLGDGLLLSGGDKWSRHRRMLTPAFHFNILKPYMKIFNKSVNIMHDKWQRLASEGSARLDMFEHISLMTLDSLQKCVFSFESNCQEKPSEYIAAILELSAFVEKRNQQILLHTDFLYYLTPDGQRFRRACHLVHDFTDAVIQERRRTLPTQGIDDFLKNKAK
Description This gene, CYP4F11, encodes a member of the cytochrome P450 superfamily of enzymes
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.