BTN3A1 Recombinant Protein (OPCA02607)

Name BTN3A1 Recombinant Protein (OPCA02607)
Supplier Aviva Systems Biology
Catalog OPCA02607
Category Protein
Prices $250.00
Sizes 50 µg
Nature Recombinant
Source Mouse
Tag/Conjugation His-tag
Purity Greater than 90% as determined by SDS-PAGE.
SwissProt/Accession O00481
Gene BTN3A1
Sequence QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAG
Description The butyrophilin (BTN) genes are a group of major histocompatibility complex (MHC)-associated genes that encode type I membrane proteins with 2 extracellular immunoglobulin (Ig) domains and an intracellular B30.2 (PRYSPRY) domain
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.