LGR5 Recombinant Protein (OPCA02708)

Name LGR5 Recombinant Protein (OPCA02708)
Supplier Aviva Systems Biology
Catalog OPCA02708
Category Protein
Prices $250.00
Sizes 50 µg
Nature Recombinant
Source Human
Tag/Conjugation His-tag
Purity Greater than 90% as determined by SDS-PAGE.
SwissProt/Accession O75473
Gene LGR5
Sequence GSSPRSGVLLRGCPTHCHCEPDGRMLLRVDCSDLGLSELPSNLSVFTSYLDLSMNNISQLLPNPLPSLRFLEELRLAGNALTYIPKGAFTGLYSLKVLMLQNNQLRHVPTEALQNLRSLQSLRLDANHISYVPPSCFSGLHSLRHLWLDDNALTEIPVQAFRSLSALQAMTLALNKIHHIPDYAFGNLSSLVVLHLHNNRIHSLGKKCFDGLHSLETLDLNYNNLDEFPTAIRTLSNLKELGFHSNNIRSIPEKA
Description The protein encoded by this gene is a leucine-rich repeat-containing receptor (LGR) and member of the G protein-coupled, 7-transmembrane receptor (GPCR) superfamily
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.