SLC27A2 Recombinant Protein (OPCA02795)

Name SLC27A2 Recombinant Protein (OPCA02795)
Supplier Aviva Systems Biology
Catalog OPCA02795
Category Protein
Prices $250.00
Sizes 50 µg
Nature Recombinant
Source Human
Tag/Conjugation His-tag
Purity Greater than 90% as determined by SDS-PAGE.
SwissProt/Accession O14975
Gene SLC27A2
Sequence GATLALRTKFSASQFWDDCRKYNVTVIQYIGELLRYLCNSPQKPNDRDHKVRLALGNGLRGDVWRQFVKRFGDICIYEFYAATEGNIGFMNYARKVGAVGRVNYLQKKIITYDLIKYDVEKDEPVRDENGYCVRVPKGEVGLLVCKITQLTPFNGYAGAKAQTEKKKLRDVFKKGDLYFNSGDLLMVDHENFIYFHDRVGDTFRWKGENVATTEVADTVGLVDFVQEVNVYGVHVPDHEGRIGMASIKMKENHEF
Description The protein encoded by this gene is an isozyme of long-chain fatty-acid-coenzyme A ligase family
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.