Active human IL1 alpha full length protein
| Name | Active human IL1 alpha full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab174089 |
| Category | Protein |
| Prices | $186.00 |
| Sizes | 10 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Purity | > 97 % by SDS-PAGE. |
| Bioactivity | The bio-activity was determined by dose-dependent stimulation of the proliferation of Mouse D10S cells. ED 50 <1pg/ml, corresponding to a specific activity of >1X10 9 Unit/mg. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P01583 |
| Gene | IL1A |
| Residue | 113 to 271 |
| Sequence | SAPFSFLSNVKYNFMRIIKYEFILNDANQSIIRANDQYLTAAALHNLDEA VKFMGAYKSSKDDAKITVILRISKTQLYVTAQDEDPVLLKEMPEIPKTIT GSETNLLFFWETGTKNYFTSVAHPNLFIATKQDYWVCLAGGPSITDFQIL ENQA |
| Supplier Page | Shop |
Product images
SDS-PAGE analysis of reduced ab174089. Staining overnight with Coomassie Blue. Calculated MW of 18 kDa. DTT-reduced protein migrates as 22 kDa estimated polypeptide in SDS-PAGE.