Human OSM, 209 a.a protein

Name Human OSM, 209 a.a protein
Supplier Biorbyt
Catalog orb168973
Category Protein
Prices $170.00, $289.00
Sizes 2 μg, 10 μg
Applications SDS-PAGE
Species Reactivities Human
Purity >97.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Bioactivity The ED50 as determined by the dose-dependant stimulation of Human TF-1 cells is < 2 ng/ml, corresponding to a Specific Activity of 500,000 IU/mg.
Gene CCM2
Sequence AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFKWGESPNRSRRHSPHQALRKGVRR.
Description Recombinant of Human OSM, 209 a.a protein
Supplier Page Shop