Active human IL1RA full length protein
| Name | Active human IL1RA full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab83761 |
| Category | Protein |
| Prices | $340.00 |
| Sizes | 5 µg |
| Applications | SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Purity | > 95 % by SDS-PAGE. |
| Bioactivity | Activity: The ED 50 of IL1RA is typically 30-100 ng/ml as measured by its ability to inhibit IL1 mediated proliferation using the murine D10S cell line. |
| SwissProt/Accession | P18510 |
| Gene | IL1RN |
| Sequence | Theoretical Sequence: RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDV VPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDK RFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVT KFYFQEDE |
| Supplier Page | Shop |
Product images
Densitometry of protein isoforms visualised by 2-DE. The densitometry scan demonstrates the purified human cell expressed protein exists in multiple isoforms, which differ according to their level of post-translational modification. The triangle indicates the theoretical MW and pI of the protein.
1D SDS-PAGE of ab83761 before and after treatment with glycosidases to remove oligosaccharides. Lane 1: ab83761 Lane 2: ab83761 treated with PNGase F to remove potential N-linked glycans. Lane 3: ab83761 treated with a glycosidase cocktail to remove potential N- and O-linked glycans. 10 µg protein loaded per lane. Drop in MW after treatment with PNGase F indicates the presence of N-linked glycans. Faint bands in lane 3 and lane 4 are glycosidase enzymes.