Human MIP 5 protein

• Supplier: Biorbyt
• Catalog: orb168835
• Category: Protein
• Prices: $170.00, $289.00
• Sizes: 5 μg, 25 μg
• Applications: SDS-PAGE
• Species Reactivities: Human
• Purity: >97.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
• Bioactivity: Determined by its ability to chemoattract human T-lymphocytes using a concentration range of 1-10 ng/ml corresponding to a Specific Activity of 100,000-1,000,000IU/mg.
• Gene: CCL15
• Sequence: QFINDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKP GVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI.
• Description: Recombinant of Human MIP 5 protein