Human CCL16 protein

• Supplier: Biorbyt
• Catalog: orb168049
• Category: Protein
• Prices: $170.00, $289.00
• Sizes: 5 μg, 20 μg
• Applications: SDS-PAGE
• Species Reactivities: Human
• Purity: >97.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
• Bioactivity: Determined by its ability to chemoattract total human monocytes using a concentration range of 10-100 ng/ml corresponding to a Specific Activity of 10,000-100,000IU/mg.
• Gene: CCL16
• Sequence: QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNP NDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ.
• Description: Recombinant of Human CCL16 protein