eEF1A2 binding protein Recombinant Protein Antigen

Name eEF1A2 binding protein Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-48962PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody eEF1A2 binding protein Antibody
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene IGFN1
Sequence AHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIYTNRFTLLGILPGHEYHFRVVA
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human eEF1A2 binding protein
Supplier Page Shop