Renal Cell Carcinoma (gp200) Recombinant Protein Antigen

• Supplier: Novus Biologicals
• Catalog: NBP2-48926PEP
• Category: Protein
• Prices: $199.00
• Sizes: 100 µl
• For Antibody: Renal Cell Carcinoma (gp200) Antibody
• Species Reactivities: Human
• Nature: Recombinant
• Source: E. coli
• Purity: >80% by SDS-PAGE and Coomassie blue staining
• Gene: LY75
• Sequence: LRWTAYEKINKWTDNRELTYSNFHPLLVSGRLRIPENFFEEESRYHCALILNLQKSPFTGTWNFTSCSERHFVSLCQKYSEVKSRQTLQNASETVKYLNN
• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Renal Cell Carcinoma (gp200)