CESK1 Recombinant Protein Antigen

Name CESK1 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-48829PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody CESK1 Antibody
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene CCT8L2
Sequence EGIINVAQEGVWDTLIVKAQGFRAVAEVVLQLVTVDEIVVAKK
Description A recombinant protein to CESK1
Supplier Page Shop