NPY4R Recombinant Protein Antigen

Name NPY4R Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-82534PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody NPY4R Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene NPY4R
Sequence NTNFKKEIKALVLTCQQSAPLEESEHLPLSTVHTEVSKGSPRLSGRSN
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPYR1
Supplier Page Shop