Active human KMT5A / SETD8 / Pr-SET7 protein fragment
| Name | Active human KMT5A / SETD8 / Pr-SET7 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab196432 |
| Category | Protein |
| Prices | $858.00 |
| Sizes | 50 µg |
| Applications | SDS-PAGE FA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Tag/Conjugation | GST tag N-Terminus |
| Purity | >= 84 % by SDS-PAGE. |
| Bioactivity | 50 µl reaction mix (50 mM Tris, pH 8.8, 1 mM EDTA, 1 mM DTT, 40 µM S-adenosylhomocysteine, and 0-6 µg ab196432) is added to the wells coated with the substrate. Incubate for 2 hr. Add antibody against methylated residue of histone H4, incubate 1 hr. Then, add secondary HRP-labeled antibody and incubate 30 min. Finally, add HRP chemiluminsecent substrates and read luminescence. |
| SwissProt/Accession | Q9NQR1 |
| Gene | SETD8 |
| Residue | 195 to 352 |
| Sequence | KAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVE YHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLG RLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASI EAHPWLKH |
| Supplier Page | Shop |
