Human HYAL1 protein fragment
| Name | Human HYAL1 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab112305 |
| Category | Protein |
| Applications | ELISA SDS-PAGE WB |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Bioactivity | useful for Antibody Production and Protein Array |
| SwissProt/Accession | Q12794 |
| Gene | HYAL1 |
| Residue | 60 to 159 |
| Sequence | ANPGQTFRGPDMTIFYSSQLGTYPYYTPTGEPVFGGLPQNASLIAHLART FQDILAAIPAPDFSGLAVIDWEAWRPRWAFNWDTKDIYRQRSRALVQAQH |
| Supplier Page | Shop |
Product images
ab112305 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.