Recombinant Human Mediator of RNA polymerase II transcription subunit 1(MED1),partial

Name Recombinant Human Mediator of RNA polymerase II transcription subunit 1(MED1),partial
Supplier Signalway Antibody
Catalog AP74605
Category Protein
Prices $155.00, $390.00, $665.00, $1,090.00, $1,835.00, $2,915.00
Sizes 10 µg, 50 µg, 100 µg, 200 µg, 500 µg, 1 mg
Species Reactivities Human
Nature Recombinant
Source E.coli
Tag/Conjugation N-terminal 6xHis-SUMO-tagged
Gene MED1
Sequence FGEEYFDESSQSGDNDDFKGFASQALNTLGVPMLGGDNGETKFKGNNQADTVDFSIISVAGKALAPADLMEHHSGSQGPLLTTGDLGKEKTQKRVKEGNGTSNSTLSGPGLDSKPGKRSRTPSNDGKSKDKPPKRKKADTEGKSPSHSSSNRPF
Description Recombinant Protein
Supplier Page Shop

Product images