Active human LEC full length protein
| Name | Active human LEC full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab194163 |
| Category | Protein |
| Prices | $155.00 |
| Sizes | 10 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Mammalian |
| Tag/Conjugation | StrepII tag N-Terminus |
| Purity | >95% by SDS-PAGE . Chemically-defined, serum- and animal-product-free culture medium |
| Bioactivity | ED 50 is 0.1-1 ng/ml as determined by a HEK293 cell proliferation assay. |
| Endotoxin | < 0.100 Eu/µg |
| SwissProt/Accession | O15467 |
| Gene | CCL16 |
| Residue | 24 to 120 |
| Sequence | QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNR EVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ |
| Supplier Page | Shop |
