Active human LEC full length protein

Name Active human LEC full length protein
Supplier Abcam
Catalog ab116400
Category Protein
Prices $192.00
Sizes 5 µg
Applications FA SDS-PAGE HPLC
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity > 97 % by SDS-PAGE. ab116400 purified by proprietary chromatographic techniques.
Bioactivity Determined by its ability to chemoattract total human monocytes using a concentration range of 10-100 ng/ml corresponding to a Specific Activity of 1,000-10,000IU/mg.
SwissProt/Accession O15467
Gene CCL16
Residue 24 to 120
Sequence QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNR EVCTNP NDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ
Supplier Page Shop