U2AF1L4 Recombinant Protein Antigen

Name U2AF1L4 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-55898PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody U2AF1L4 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene U2AF1L4
Sequence PRGSILATIPERGTIGVPLITGMAASEALAPLPFTPNRDRCSWQDLSSKP
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human U2AF1L4
Supplier Page Shop