UNC5H1/Unc5a Recombinant Protein Antigen

Name UNC5H1/Unc5a Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-57451PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody UNC5H1/Unc5a Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene UNC5A
Sequence VSPSTSDLACKLWVWQVEGDGQSFSINFNITKDTRFAELLALESEAGVPALVGPSAFKIPFLIRQKIIS
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human UNC5H1/Unc5a
Supplier Page Shop