P2Y10/P2RY10 Recombinant Protein Antigen

Name P2Y10/P2RY10 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-56283PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody P2Y10/P2RY10 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene P2RY10
Sequence MASEFRDQLSRHGSSVTRSRLMSKESGSSMIG
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human P2Y10/P2RY10
Supplier Page Shop