Brp16 Recombinant Protein Antigen

Name Brp16 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-54697PEP
Category Protein
Prices $229.00
Sizes 100 µl
For Antibody Brp16 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene HGH1
Sequence LVEAIMLLTATAPGRQQVRDQGAYLILRELHSWEPEPDVRTACEKLIQVLIGDEPERGMENLLEVQVPEDVEQQLQQLDCREQEQLEREL
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Brp16 Source: E.coli Amino Acid Sequence: LVEAIMLLTATAPGRQQVRDQGAYLILRELHSWEPEPDVRTACEKLIQVLIGDEPERGMENLLEVQVPEDVEQQLQQLDCREQEQLEREL
Supplier Page Shop