FLJ13946 Recombinant Protein Antigen

Name FLJ13946 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-46805PEP
Category Protein
Prices $229.00
Sizes 100 µl
For Antibody FLJ13946 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene TTC30A
Sequence LSYNLALAYYSSRQYASALKHIAEIIERGIRQHPELGVGMTTEGFDVRSVGNTLVLHQTALVEA
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FLJ13946 Source: E.coli Amino Acid Sequence: LSYNLALAYYSSRQYASALKHIAEIIERGIRQHPELGVGMTTEGFDVRSVGNTLVLHQTALVEA
Supplier Page Shop