SLC17A1/NPT Recombinant Protein Antigen

Name SLC17A1/NPT Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-55004PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody SLC17A1/NPT Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene SLC17A1
Sequence CLNLTMVVMVNSTDPHGLPNTSTKKLLDNIKNPMYNWSPDI
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC17A1/NPT. Source: E.coli Amino Acid Sequence: CLNLTMVVMVNSTDPHGLPNTSTKKLLDNIKNPMYNWSPDI
Supplier Page Shop