ACCN2 Recombinant Protein Antigen

Name ACCN2 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-58458PEP
Category Protein
Prices $199.00
Sizes 100 µl
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene ASIC1
Sequence LALLNNRYEIPDTQMADEKQLEILQDKANFRSFKPKPFNMREFYDRAGHDIRDMLLSCHFRGEVCSAEDFKVVFT
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ACCN2
Supplier Page Shop