G5pr Recombinant Protein Antigen

Name G5pr Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-58168PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody G5pr Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene PPP2R3C
Sequence LATPNTCPNKKKSEQELKDEEMDLFTKYYSEWKGGRKNTNEFYKTIPRFYYRLPAEDEVLLQKLREESRAVFLQRKSRELLDNEELQNLWFLLDKHQTPPMIGEEAMINYENF
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human G5pr
Supplier Page Shop