CBARA1 Recombinant Protein Antigen

Name CBARA1 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-58173PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody CBARA1 Antibody
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene MICU1
Sequence IFYTLGECGLISFSDYIFLTTVLSTPQRNFEIAFKMFDLNGDGEVDMEEFEQVQSIIRSQTSMGMRHRDRPTTGNTLKSGLCSALTTY
Description A recombinant protein to CBARA1
Supplier Page Shop