U2AF2 Recombinant Protein Antigen

Name U2AF2 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-58989PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody U2AF2 Antibody
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene U2AF2
Sequence LTRGAKEEHGGLIRSPRHEKKKKVRKYWDVPPPGFEHITPMQYKAMQAAGQIPATALLPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEEA
Description A recombinant protein to U2AF2
Supplier Page Shop