PJA2/Praja2 Recombinant Protein Antigen

Name PJA2/Praja2 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-56901PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody PJA2/Praja2 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene PJA2
Sequence DEMVSTKQQNNTSQERQTEHSPEDAACGPGHICSEQNTNDREKNHGSSPEQVVRPKVRKLISSSQVDQETGFNRHEAKQRSVQRW
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PJA2/Praja2
Supplier Page Shop