SMC6L1 Recombinant Protein Antigen

Name SMC6L1 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-55146PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody SMC6L1 Antibody
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene SMC6
Sequence ADERVLQALMKRFYLPGTSRPPIIVSEFRNEIYDVRHRAAYHPDFPTVLTALEIDNAVVANSLIDMRGIETVLLIKNNSVARAVMQSQKP
Description A recombinant protein to SMC6L1
Supplier Page Shop