Recombinant Human Band 3 anion transport protein (SLC4A1),Partial

Name Recombinant Human Band 3 anion transport protein (SLC4A1),Partial
Supplier Cusabio
Catalog CSB-EP021663HUb1
Category Protein
Species Reactivities Human
Nature Recombinant
Source E.coli
Tag/Conjugation N-terminal 10xHis-tagged and C-terminal Myc-t
Purity Greater than 90% as determined by SDS-PAGE.
SwissProt/Accession P02730
Gene SLC4A1
Residue 1-403aa
Sequence MEELQDDYEDMMEENLEQEEYEDPDIPESQMEEPAAHDTEATATDYHTTSHPGTHKVYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRSGDPSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSSPAKPDSSFYKGLDLNGGPDDPLQQTGQLFGGLVRDIRRRYPYYLSDITDAFSP
Description Partial
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.