Human IGF1 full length protein
| Name | Human IGF1 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab87177 |
| Category | Protein |
| Applications | SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | > 95 % by SDS-PAGE. ab87177 was purified by conventional chromatography, after refolding of the isolated inclusion bodies in a renaturation buffer. |
| SwissProt/Accession | P05019 |
| Gene | IGF1 |
| Residue | 49 to 118 |
| Sequence | GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFR SCDLRRLEMYCAPLKPAKSA |
| Supplier Page | Shop |
Product images
14% SDS-PAGE showing ab87177 (mature protein)