| Name | Active human Macrophage Inflammatory Protein 3 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab138793 |
| Category | Protein |
| Prices | $239.00 |
| Sizes | 10 µg |
| Applications | HPLC SDS-PAGE FA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >95% by SDS-PAGE . Purity is > 98% as determined by RP-HPLC; > 95% as determined by reducing SDS-PAGE. |
| Bioactivity | The ED 50 of ab138793 was 0.2-0.5 µg/mL as determined by its ability to chemoattract THP1 human acute monocytic leukemia cells. The ED 50 of ab138793 was 0.02-0.1 µg/mL as determined by its ability to chemoattract human CCR1 transfected BaF3 mouse proB cells. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P55773 |
| Gene | CCL23 |
| Residue | 22 to 120 |
| Sequence | RVTKDAETEFMMSKLPLENPVLLDRFHATSADCCISYTPRSIPCSLLESY FETNSECSKPGVIFLTKKGRRFCANPSDKQVQVCVRMLKLDTRIKTRKN |
| Supplier Page | Shop |