Active human Macrophage Inflammatory Protein 3 full length protein

• Supplier: Abcam
• Catalog: ab192098
• Category: Protein
• Prices: $192.00
• Sizes: 20 µg
• Applications: FA SDS-PAGE
• Species Reactivities: Human
• Nature: Recombinant
• Source: E. coli
• Purity: >95% by SDS-PAGE .
• Bioactivity: Determined by its ability to chemoattract Human T cells using a concentration range of 2-40 ng/mL.
• Endotoxin: < 1.000 Eu/µg
• SwissProt/Accession: P55773
• Gene: CCL23
• Residue: 22 to 120
• Sequence: RVTKDAETEFMMSKLPLENPVLLDRFHATSADCCISYTPRSIPCSLLESY FETNSECSKPGVIFLTKKGRRFCANPSDKQVQVCVRMLKLDTRIKTRKN