Active human Macrophage inflammatory protein 5 full length protein

• Supplier: Abcam
• Catalog: ab192142
• Category: Protein
• Prices: $192.00
• Sizes: 25 µg
• Applications: SDS-PAGE FA
• Species Reactivities: Human
• Nature: Recombinant
• Source: E. coli
• Purity: >95% by SDS-PAGE .
• Bioactivity: Determined by its ability to chemoattract Human monocytes using a concentration range of 2-40 ng/mL.
• Endotoxin: < 1.000 Eu/µg
• SwissProt/Accession: Q16663
• Gene: CCL15
• Residue: 22 to 113
• Sequence: QFINDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYF ETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI