Human Kappa Opioid Receptor protein fragment
| Name | Human Kappa Opioid Receptor protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab114296 |
| Category | Protein |
| Applications | WB SDS-PAGE ELISA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| SwissProt/Accession | P41145 |
| Gene | OPRK1 |
| Residue | 1 to 58 |
| Sequence | MDSPIQIFRGEPGPTCAPSACLPPNSSAWFPGWAEPDSNGSAGSEDAQLE PAHISPAI |
| Supplier Page | Shop |
Product images
12.5% SDS-PAGE image showing ab114296 at approx 32.01 kDa. Stained with Coomassie Blue.