Human KDM5A / Jarid1A / RBBP2 protein fragment
| Name | Human KDM5A / Jarid1A / RBBP2 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab112347 |
| Category | Protein |
| Applications | SDS-PAGE WB ELISA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Bioactivity | useful for Antibody Production and Protein Array |
| SwissProt/Accession | P29375 |
| Gene | KDM5A |
| Residue | 191 to 290 |
| Sequence | KVEPEVLSTDTQTSPEPGTRMNILPKRTRRVKTQSESGDVSRNTELKKLQ IFGAGPKVVGLAMGTKDKEDEVTRRRKVTNRSDAFNMQMRQRKGTLSVNF |
| Supplier Page | Shop |
Product images
12.5% SDS-PAGE showing ab112347 at approximately 36.63kDa stained with Coomassie Blue.